HPA030055

CRISPLD2 antibody from MilliporeSigma / Merck KGaA
DKFZP434B044, LCRISP2, LGL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030055
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030055, RRID:AB_10611821
Product name
Anti-CRISPLD2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030055
Antibody type
Polyclonal
Antigen
cysteine-rich secretory protein LCCL domain containing 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRN
NLCYREETYTPKPETDEMNEVETAPIPEENHVWLQ
PRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKGS
TCNRYQCPAGCLNHKAKIFGSLFYESSS
Storage
-20C
Provider Type Product Number
- No reagents -