HPA027279

COQ8B antibody from Sigma-Aldrich
ADCK4, COQ8, FLJ12229
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027279
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027279, RRID:AB_10601219
Product name
Anti-ADCK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027279
Antibody type
Polyclonal
Antigen
aarF domain containing kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVP
FAAASIGQVHQGLLRDGTEVAVKIQY
Storage
-20C
Provider Type Product Number
- No reagents -