HPA018226

TMEM186 antibody from MilliporeSigma / Merck KGaA
C16orf51, DKFZP564K2062
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018226
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018226, RRID:AB_1845579
Product name
Anti-C16orf51 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018226
Antibody type
Polyclonal
Antigen
Transmembrane protein 186 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKAVWERPLHGLWCCSGQEDPKRWVGSSSPISKEK
LPNAETEKFWMFYRFDAI
Storage
-20C
Provider Type Product Number
- No reagents -