H00055625-M03A

ZDHHC7 antibody from Abnova Corporation
DHHC7, FLJ10792, FLJ20279, SERZ-B, SERZ1, ZNF370
No application information provided.

Antibody data

Product number
H00055625-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055625-M03A, RRID:AB_1582005
Product name
ZDHHC7 monoclonal antibody (M03A), clone 3D8
Provider product page
Abnova Corporation - H00055625-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ZDHHC7.
Antigen sequence
MLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKC
CCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEK
NQRFFVLFTMYIALSSVHALILCGFQFISCVRGQW
TECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGT
QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVF
GGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV
Isotype
IgM
Antibody clone number
3D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -