Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502258 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RALGPS1 antibody: synthetic peptide directed towards the middle region of human RALGPS1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSAT
FPSEK ARHLLDDSVL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references RalGEF2, a pleckstrin homology domain containing guanine nucleotide exchange factor for Ral.
de Bruyn KM, de Rooij J, Wolthuis RM, Rehmann H, Wesenbeek J, Cool RH, Wittinghofer AH, Bos JL
The Journal of biological chemistry 2000 Sep 22;275(38):29761-6
The Journal of biological chemistry 2000 Sep 22;275(38):29761-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting