PAB28314
antibody from Abnova Corporation
Targeting: MAGEA11
CT1.11, MAGE-11, MAGE11, MAGEA-11, MGC10511
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28314 - Provider product page
- Provider
- Abnova Corporation
- Product name
- MAGEA11 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of recombinant MAGEA11.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SPASIKRKKKREDSGDFGLQVSTMFSEDDFQSTER
APYGPQLQWSQDLPRVQVFREQANLEDRSPRRTQR
ITGGEQVLWGPITQIFPTVR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4 Lane 2: U-251 MG Lane 3: Human Plasma Lane 4: Liver Lane 5: Tonsil with MAGEA11 polyclonal antibody ( Cat # PAB28314) at 1:100-1:250 dilution.
- Validation comment
- Western Blot
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with MAGEA11 polyclonal antibody ( Cat # PAB28314 ) at 1-4 ug/mL dilution shows positivity in nucleus & cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis with MAGEA11 polyclonal antibody ( Cat # PAB28314 ) shows strong cytoplasmic and nuclear positivity in subsets of cells in seminiferus ducts and strong cytoplasmic staining in Leydig cells at 1:200 - 1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)