HPA014388

SDR42E1 antibody from Sigma-Aldrich
HSPC105
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014388
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014388, RRID:AB_1851226
Product name
Anti-SDR42E1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014388
Antibody type
Polyclonal
Antigen
3-beta-HSD family protein HSPC105 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPF
DLQEAVEWFKAHGHGRSSGSRDSEC
Storage
-20C
Provider Type Product Number
- No reagents -