H00010507-M01
antibody from Abnova Corporation
Targeting: SEMA4D
C9orf164, CD100, coll-4, FLJ39737, SEMAJ
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010507-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010507-M01, RRID:AB_489890
- Product name
- SEMA4D monoclonal antibody (M01), clone 3B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SEMA4D.
- Antigen sequence
LQPLSATSLYVCGTNAFQPACDHLNLTSFKFLGKN
EDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGS
EPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRK
SPDSP- Isotype
- IgG
- Antibody clone number
- 3B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Phage display identification of CD100 in human atherosclerotic plaque macrophages and foam cells.
Luque MC, Gutierrez PS, Debbas V, Martins WK, Puech-Leao P, Porto G, Coelho V, Boumsell L, Kalil J, Stolf B
PloS one 2013;8(9):e75772
PloS one 2013;8(9):e75772
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SEMA4D monoclonal antibody (M01), clone 3B4 Western Blot analysis of SEMA4D expression in HL-60 ( Cat # L014V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SEMA4D is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol