HPA015662

SEMA4D antibody from Sigma-Aldrich
C9orf164, CD100, coll-4, FLJ39737, SEMAJ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015662
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015662, RRID:AB_1856671
Product name
Anti-SEMA4D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015662
Antibody type
Polyclonal
Antigen
Semaphorin-4D precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGE
HPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
Storage
-20C
Provider Type Product Number
- No reagents -