HPA015662

SEMA4D antibody from Atlas Antibodies
C9orf164, CD100, coll-4, FLJ39737, SEMAJ
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015662
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015662, RRID:AB_1235516
Product name
Anti-SEMA4D
Provider product page
Atlas Antibodies - HPA015662
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGE
HPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -