HPA015662

SEMA4D antibody from Atlas Antibodies
C9orf164, CD100, coll-4, FLJ39737, SEMAJ
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015662
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015662, RRID:AB_1856671
Product name
Anti-SEMA4D
Provider product page
Atlas Antibodies - HPA015662
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGE
HPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -