Antibody data

Product number
ABIN405801
Provider
antibodies-online
Product name
anti-GINS Complex Subunit 2 (Psf2 Homolog) (GINS2) (N-Term) antibody
Provider product page
antibodies-online - ABIN405801
Antibody type
Polyclonal
Antigen
The immunogen for anti-GINS2 antibody: synthetic peptide directed towards the N terminal of human GINS2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPF
NPGLP VEVPLWLAIN
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.