Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405801 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-GINS Complex Subunit 2 (Psf2 Homolog) (GINS2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GINS2 antibody: synthetic peptide directed towards the N terminal of human GINS2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPF
NPGLP VEVPLWLAIN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ
Science (New York, N.Y.) 2007 May 25;316(5828):1160-6
Science (New York, N.Y.) 2007 May 25;316(5828):1160-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting