Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA057143 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA057143, RRID:AB_2683349
- Product name
- Anti-NUAK1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LLDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGI
LKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Localized Inhibition of Protein Phosphatase 1 by NUAK1 Promotes Spliceosome Activity and Reveals a MYC-Sensitive Feedback Control of Transcription
Cossa G, Roeschert I, Prinz F, Baluapuri A, Silveira Vidal R, Schülein-Völk C, Chang Y, Ade C, Mastrobuoni G, Girard C, Kumar A, Wortmann L, Walz S, Lührmann R, Kempa S, Kuster B, Wolf E, Mumberg D, Eilers M
Molecular Cell 2020;77(6):1322-1339.e11
Molecular Cell 2020;77(6):1322-1339.e11
No comments: Submit comment
No validations: Submit validation data