HPA027455

NUAK1 antibody from Sigma-Aldrich
ARK5, KIAA0537, NuaK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027455
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027455, RRID:AB_10602013
Product name
Anti-NUAK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027455
Antibody type
Polyclonal
Antigen
NUAK family, SNF1-like kinase, 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPAR
QRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRN
RLADSSFSLLTDMDDVTQVYKQ
Storage
-20C
Provider Type Product Number
- No reagents -