H00010328-B01P

EMC8 antibody from Abnova Corporation
C16orf2, C16orf4, COX4NB, FAM158B, NOC4

Antibody data

Product number
H00010328-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010328-B01P, RRID:AB_1573140
Product name
COX4NB purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010328-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human COX4NB protein.
Antigen sequence
MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQ
KPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPM
LEVALTLIDSWCKDHSYVIAGYYQANERVKDASPN
QVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPT
IHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLL
DSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -