Antibody data

Product number
H00009965-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009965-M01, RRID:AB_1574856
Product name
FGF19 monoclonal antibody (M01), clone 4C4
Provider product page
Abnova Corporation - H00009965-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FGF19.
Antigen sequence
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVH
YGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDC
ARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGA
DGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHR
LPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEE
PEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVR
SPSFEK
Isotype
IgG
Antibody clone number
4C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -