Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055703-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055703-M01, RRID:AB_1204815
- Product name
- POLR3B monoclonal antibody (M01), clone 3G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant POLR3B.
- Antigen sequence
DVLAEEFGNLTPEQLAAPIPTVEEKWRLLPAFLKV
KGLVKQHIDSFNYFINVEIKKIMKANEKVTSDADP
MWYLKYLNIYVGLPDVEESFNVTRPVSPH- Isotype
- IgG
- Antibody clone number
- 3G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification and characterization of INMAP, a novel interphase nucleus and mitotic apparatus protein that is involved in spindle formation and cell cycle progression.
Shen E, Lei Y, Liu Q, Zheng Y, Song C, Marc J, Wang Y, Sun L, Liang Q
Experimental cell research 2009 Apr 15;315(7):1100-16
Experimental cell research 2009 Apr 15;315(7):1100-16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged POLR3B is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol