H00081631-A02

MAP1LC3B antibody from Abnova Corporation
ATG8F
No application information provided.

Antibody data

Product number
H00081631-A02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00081631-A02, RRID:AB_1139214
Product name
MAP1LC3B polyclonal antibody (A02)
Provider product page
Abnova Corporation - H00081631-A02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant MAP1LC3B.
Antigen sequence
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVII
ERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR
LQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDE
DGFLYMVYASQETFGMKLSV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -