Antibody data

Product number
PAB20712
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20712, RRID:AB_10961947
Product name
TMEM207 polyclonal antibody
Provider product page
Abnova Corporation - PAB20712
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TMEM207.
Antigen sequence
LRRPRIDSHRRTMAVFAVGDLDSIYGTEAAVSPTV
GIHLQTQTPDLYPVPAPCF
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -