Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405671 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KIAA1754L antibody: synthetic peptide directed towards the C terminal of human KIAA1754L
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQN
LLTQV KTLPHAPLAA- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
Lim J, Hao T, Shaw C, Patel AJ, Szabó G, Rual JF, Fisk CJ, Li N, Smolyar A, Hill DE, Barabási AL, Vidal M, Zoghbi HY
Cell 2006 May 19;125(4):801-14
Cell 2006 May 19;125(4):801-14
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting