HPA017985

ITPRIPL1 antibody from Sigma-Aldrich
KIAA1754L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017985
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017985, RRID:AB_1852431
Product name
Anti-ITPRIPL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017985
Antibody type
Polyclonal
Antigen
Inositol 1,4,5-triphosphate receptor-interacting protein-like 1 precursor
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVTSYNWLTDFPSQEALDSFYKHYVQNAIRDLPCT
CEFVESFVDDLIEACRVLSRQEAHPQLEDCLGIGA
AFEKWGTLHETQKFDILVPIVPPQGTMFVLEMRDP
ALGRRCGCVLVESECVCKREKLLGDVL
Storage
-20C
Provider Type Product Number
- No reagents -