HPA027183

NUDC antibody from Sigma-Aldrich
NudC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027183
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027183, RRID:AB_10600086
Product name
Anti-NUDC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027183
Antibody type
Polyclonal
Antigen
nuclear distribution gene C homolog (A. nidulans) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDS
PGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRW
T
Storage
-20C
Provider Type Product Number
- No reagents -