Antibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00150684-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00150684-M01, RRID:AB_509129
- Product name
- COMMD1 monoclonal antibody (M01), clone 2A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant COMMD1.
- Antigen sequence
MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELL
RSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN
QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKI
RESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT
PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTL
SEVEESISTLISQPN- Isotype
- IgG
- Antibody clone number
- 2A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references p300-mediated acetylation of COMMD1 regulates its stability, and the ubiquitylation and nucleolar translocation of the RelA NF-κB subunit.
Radiosensitization of normoxic and hypoxic h1339 lung tumor cells by heat shock protein 90 inhibition is independent of hypoxia inducible factor-1α.
COMMD1-mediated ubiquitination regulates CFTR trafficking.
Cu,Zn superoxide dismutase maturation and activity are regulated by COMMD1.
COMMD1 forms oligomeric complexes targeted to the endocytic membranes via specific interactions with phosphatidylinositol 4,5-bisphosphate.
Copper-induced translocation of the Wilson disease protein ATP7B independent of Murr1/COMMD1 and Rab7.
Tumor suppressor ARF promotes non-classic proteasome-independent polyubiquitination of COMMD1.
Distinct Wilson's disease mutations in ATP7B are associated with enhanced binding to COMMD1 and reduced stability of ATP7B.
COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase.
O'Hara A, Simpson J, Morin P, Loveridge CJ, Williams AC, Novo SM, Stark LA
Journal of cell science 2014 Sep 1;127(Pt 17):3659-65
Journal of cell science 2014 Sep 1;127(Pt 17):3659-65
Radiosensitization of normoxic and hypoxic h1339 lung tumor cells by heat shock protein 90 inhibition is independent of hypoxia inducible factor-1α.
Schilling D, Bayer C, Li W, Molls M, Vaupel P, Multhoff G
PloS one 2012;7(2):e31110
PloS one 2012;7(2):e31110
COMMD1-mediated ubiquitination regulates CFTR trafficking.
Drévillon L, Tanguy G, Hinzpeter A, Arous N, de Becdelièvre A, Aissat A, Tarze A, Goossens M, Fanen P
PloS one 2011 Mar 31;6(3):e18334
PloS one 2011 Mar 31;6(3):e18334
Cu,Zn superoxide dismutase maturation and activity are regulated by COMMD1.
Vonk WI, Wijmenga C, Berger R, van de Sluis B, Klomp LW
The Journal of biological chemistry 2010 Sep 10;285(37):28991-9000
The Journal of biological chemistry 2010 Sep 10;285(37):28991-9000
COMMD1 forms oligomeric complexes targeted to the endocytic membranes via specific interactions with phosphatidylinositol 4,5-bisphosphate.
Burkhead JL, Morgan CT, Shinde U, Haddock G, Lutsenko S
The Journal of biological chemistry 2009 Jan 2;284(1):696-707
The Journal of biological chemistry 2009 Jan 2;284(1):696-707
Copper-induced translocation of the Wilson disease protein ATP7B independent of Murr1/COMMD1 and Rab7.
Weiss KH, Lozoya JC, Tuma S, Gotthardt D, Reichert J, Ehehalt R, Stremmel W, Füllekrug J
The American journal of pathology 2008 Dec;173(6):1783-94
The American journal of pathology 2008 Dec;173(6):1783-94
Tumor suppressor ARF promotes non-classic proteasome-independent polyubiquitination of COMMD1.
Huang Y, Wu M, Li HY
The Journal of biological chemistry 2008 Apr 25;283(17):11453-60
The Journal of biological chemistry 2008 Apr 25;283(17):11453-60
Distinct Wilson's disease mutations in ATP7B are associated with enhanced binding to COMMD1 and reduced stability of ATP7B.
de Bie P, van de Sluis B, Burstein E, van de Berghe PV, Muller P, Berger R, Gitlin JD, Wijmenga C, Klomp LW
Gastroenterology 2007 Oct;133(4):1316-26
Gastroenterology 2007 Oct;133(4):1316-26
COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase.
Maine GN, Mao X, Komarck CM, Burstein E
The EMBO journal 2007 Jan 24;26(2):436-47
The EMBO journal 2007 Jan 24;26(2):436-47
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- COMMD1 monoclonal antibody (M01), clone 2A12 Western Blot analysis of COMMD1 expression in HeLa ( Cat # L013V1 ).
- Validation comment
- Western Blot (Cell lysate)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of COMMD1 expression in transfected 293T cell line by COMMD1 monoclonal antibody (M01), clone 2A12.Lane 1: COMMD1 transfected lysate(21.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- COMMD1 monoclonal antibody (M01), clone 2A12. Western Blot analysis of COMMD1 expression in HepG2.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged COMMD1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol