Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB24461 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB24461, RRID:AB_11122788
- Product name
- GABRE polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant GABRE.
- Antigen sequence
PQTESKNEASSRDVVYGPQPQPLENQLLSEETKST
ETETGSRVGKLPEASRILNTILSNYDHKLRPGIGE
KPTVVTVEIAVNSLGPL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Human breast cancer metastases to the brain display GABAergic properties in the neural niche.
Neman J, Termini J, Wilczynski S, Vaidehi N, Choy C, Kowolik CM, Li H, Hambrecht AC, Roberts E, Jandial R
Proceedings of the National Academy of Sciences of the United States of America 2014 Jan 21;111(3):984-9
Proceedings of the National Academy of Sciences of the United States of America 2014 Jan 21;111(3):984-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney with GABRE polyclonal antibody (Cat # PAB24461) shows strong cytoplasmic positivity in renal tubules at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)