HPA017989

SLC30A10 antibody from Atlas Antibodies
DKFZp547M236, ZnT-10, ZNT8, ZRC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017989
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017989, RRID:AB_1859483
Product name
Anti-SLC30A10
Provider product page
Atlas Antibodies - HPA017989
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIA
TLHIKYPKDRGYQDASTKIREIFHHAGIHNVTIQF
ENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPP
GALPLAHVNGCAEHNGGPSLDTYGSDGLSRRDARE
VAIEVS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -