HPA052891

SLC9A1 antibody from Atlas Antibodies
APNH, NHE1, PPP1R143
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052891
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052891, RRID:AB_2681981
Product name
Anti-SLC9A1
Provider product page
Atlas Antibodies - HPA052891
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDG
GIMMRSKETSSPGTDDVFTPAPSDSPSSQRIQRCL
SDPGPHPEPGEGEPFFPKG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -