Antibody data

Product number
H00006548-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006548-M01, RRID:AB_464116
Product name
SLC9A1 monoclonal antibody (M01), clone 2F5
Provider product page
Abnova Corporation - H00006548-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC9A1.
Antigen sequence
VLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPP
EVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVR
TPFEISLWILLACLMKIGFHVIPTISSIVP
Isotype
IgG
Antibody clone number
2F5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -