HPA041327

ZC3H18 antibody from Atlas Antibodies
NHN1

Antibody data

Product number
HPA041327
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041327, RRID:AB_10795005
Product name
Anti-ZC3H18
Provider product page
Atlas Antibodies - HPA041327
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRI
PRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.