HPA028177

WDTC1 antibody from Sigma-Aldrich
ADP, DCAF9, KIAA1037
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028177
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028177, RRID:AB_10600419
Product name
Anti-WDTC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028177
Antibody type
Polyclonal
Antigen
WD and tetratricopeptide repeats 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDQHTIVWDPLHHKKLLSMHTGHTANIFSVKFLPH
AGDRILITGAADSKVHVHDLTVKETIHMFGDHTNR
VKRIATAPMWPNTFWSAAE
Storage
-20C
Provider Type Product Number
- No reagents -