HPA015536

HADHA antibody from Sigma-Aldrich
GBP, LCEH, LCHAD, MTPA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015536
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015536, RRID:AB_1850473
Product name
Anti-HADHA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015536
Antibody type
Polyclonal
Antigen
Trifunctional enzyme subunit alpha, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAY
AMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIID
VVKTGIEQGSDAGYLCESQKFGELVMTKESKALMG
LYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGI
AQVSVDK
Storage
-20C
Provider Type Product Number
- No reagents -