HPA015536

HADHA antibody from Atlas Antibodies
GBP, LCEH, LCHAD, MTPA
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA015536
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015536, RRID:AB_1850473
Product name
Anti-HADHA
Provider product page
Atlas Antibodies - HPA015536
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IEYLEEVAITFAKGLADKKISPKRDKGLVEKLTAY
AMTIPFVRQQVYKKVEEKVRKQTKGLYPAPLKIID
VVKTGIEQGSDAGYLCESQKFGELVMTKESKALMG
LYHGQVLCKKNKFGAPQKDVKHLAILGAGLMGAGI
AQVSVDK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -