Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004102-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004102-M01, RRID:AB_530117
- Product name
- MAGEA3 monoclonal antibody (M01), clone 6D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAGEA3.
- Antigen sequence
TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYP
LWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKV
A- Isotype
- IgG
- Antibody clone number
- 6D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references α-type-1 polarized dendritic cell-based vaccination in recurrent high-grade glioma: a phase I clinical trial.
Akiyama Y, Oshita C, Kume A, Iizuka A, Miyata H, Komiyama M, Ashizawa T, Yagoto M, Abe Y, Mitsuya K, Watanabe R, Sugino T, Yamaguchi K, Nakasu Y
BMC cancer 2012 Dec 27;12:623
BMC cancer 2012 Dec 27;12:623
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MAGEA3 expression in transfected 293T cell line by MAGEA3 monoclonal antibody (M01), clone 6D10.Lane 1: MAGEA3 transfected lysate (Predicted MW: 34.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MAGEA3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
