HPA015066

CYP2C19 antibody from Sigma-Aldrich
CPCJ, CYP2C, P450IIC19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015066
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015066, RRID:AB_1847433
Product name
Anti-CYP2C19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015066
Antibody type
Polyclonal
Antigen
Cytochrome P450 2C19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFT
IENLVITAADLLGAGTETTST
Storage
-20C
Provider Type Product Number
- No reagents -