Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001069-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001069-M01, RRID:AB_489807
- Product name
- CETN2 monoclonal antibody (M01), clone 3F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CETN2.
- Antigen sequence
NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETG
KISFKNLKRVAKELGENLTDEELQEMIDEADRDGD
GEVSEQEFLRIMKKTSLY- Isotype
- IgG
- Antibody clone number
- 3F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response.
Barr AR, Kilmartin JV, Gergely F
The Journal of cell biology 2010 Apr 5;189(1):23-39
The Journal of cell biology 2010 Apr 5;189(1):23-39
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CETN2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol