Antibody data

Product number
H00118788-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00118788-M01, RRID:AB_1204793
Product name
PIK3AP1 monoclonal antibody (M01), clone 3C2
Provider product page
Abnova Corporation - H00118788-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PIK3AP1.
Antigen sequence
KTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLN
QKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQ
TDLEITVPIRHSQHLPAKVEFGVYESGPRK
Isotype
IgG
Antibody clone number
3C2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -