Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064598-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064598-M05, RRID:AB_1679070
- Product name
- MOSPD3 monoclonal antibody (M05), clone 1H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MOSPD3.
- Antigen sequence
FRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKY
TVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRF
RIELSEEGAEGRVVGRKDITSILRAPAYP- Isotype
- IgG
- Antibody clone number
- 1H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Magnetic bead-based separation of sperm from buccal epithelial cells using a monoclonal antibody against MOSPD3.
Li XB, Wang QS, Feng Y, Ning SH, Miao YY, Wang YQ, Li HW
International journal of legal medicine 2014 Nov;128(6):905-11
International journal of legal medicine 2014 Nov;128(6):905-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MOSPD3 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol