Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038438 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA038438, RRID:AB_10672645
- Product name
- Anti-ADGRF1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LENISTLVPPTALPLNFSRKFIDWKGIPVNKSQLK
RGYSYQIKMCPQNTSIPIRGRVLIGSDQFQRSLPE
TIISMASLTLGNILPVSKNGNAQVNG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Interaction between GPR110 (ADGRF1) and tight junction protein occludin implicated in blood-brain barrier permeability
A novel role of ADGRF1 (GPR110) in promoting cellular quiescence and chemoresistance in human epidermal growth factor receptor 2-positive breast cancer.
Huang B, Chen H, Joo Y, Kwon H, Fu C, Spector A, Kim H
iScience 2023;26(4):106550
iScience 2023;26(4):106550
A novel role of ADGRF1 (GPR110) in promoting cellular quiescence and chemoresistance in human epidermal growth factor receptor 2-positive breast cancer.
Abdulkareem NM, Bhat R, Qin L, Vasaikar S, Gopinathan A, Mitchell T, Shea MJ, Nanda S, Thangavel H, Zhang B, De Angelis C, Schiff R, Trivedi MV
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2021 Jul;35(7):e21719
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2021 Jul;35(7):e21719
No comments: Submit comment
No validations: Submit validation data