Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023603-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023603-M02, RRID:AB_1137146
- Product name
- CORO1C monoclonal antibody (M02), clone 1F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CORO1C.
- Antigen sequence
EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNI
LDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEI
LKEIKSIKDTICNQDERISKLEQQMAKIA- Isotype
- IgG
- Antibody clone number
- 1F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Activated Cdc42-bound IQGAP1 determines the cellular endocytic site.
Kimura T, Yamaoka M, Taniguchi S, Okamoto M, Takei M, Ando T, Iwamatsu A, Watanabe T, Kaibuchi K, Ishizaki T, Niki I
Molecular and cellular biology 2013 Dec;33(24):4834-43
Molecular and cellular biology 2013 Dec;33(24):4834-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CORO1C monoclonal antibody (M02), clone 1F7. Western Blot analysis of CORO1C expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CORO1C is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CORO1C on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
