H00008547-A01

FCN3 antibody from Abnova Corporation
FCNH, HAKA1
No application information provided.

Antibody data

Product number
H00008547-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008547-A01, RRID:AB_1139200
Product name
FCN3 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00008547-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant FCN3.
Antigen sequence
MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPREL
EASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGK
MGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRA
LPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYR
AGFGNQESEFWLGNENLHQLTLQGNWELRVELEDF
NGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGD
SLSLHSGRPLTTYDADHDSSNSNCAVIVHGAWWYA
SCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPY
RRVRMMLR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -