ARP37513_P050
antibody from Aviva Systems Biology
Targeting: LCOR
C10orf12, DKFZP564P1916, FLJ13022, FLJ38026, KIAA1795, MLR2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP37513_P050 - Provider product page

- Provider
- Aviva Systems Biology
- Proper citation
- Aviva Systems Biology Cat#ARP37513_P050, RRID:AB_2297035
- Product name
- A630025C20RIK antibody - N-terminal region (ARP37513_P050)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- This is a rabbit polyclonal antibody against A630025C20RIK. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVT
TSPTAATTQNPVLSK- Vial size
- 50 µg
- Concentration
- 1 mg/ml
- Handling
- Add 50 µl of distilled water. Final anti-A630025C20RIK antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Aviva Systems Biology (provider)
- Main image

- Experimental details
- WB Suggested Anti-A630025C20RIKAntibody Titration: 0.2-1µg/ml. ELISA Titer: 1:62500Positive Control: SP2/0 cell lysate