Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035008 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA035008, RRID:AB_10604091
- Product name
- Anti-SEMA3F
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPR
EAPGAPRSPEPQDQKKPRNRRHHPPDT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A Core Human Primary Tumor Angiogenesis Signature Identifies the Endothelial Orphan Receptor ELTD1 as a Key Regulator of Angiogenesis
The axon guidance molecule Semaphorin 3F is a negative regulator of tumor progression and proliferation in ileal neuroendocrine tumors
Oncotarget
Masiero M, Simões F, Han H, Snell C, Peterkin T, Bridges E, Mangala L, Wu S, Pradeep S, Li D, Han C, Dalton H, Lopez-Berestein G, Tuynman J, Mortensen N, Li J, Patient R, Sood A, Banham A, Harris A, Buffa F
Cancer Cell 2013 August;24(2):229-241
Cancer Cell 2013 August;24(2):229-241
The axon guidance molecule Semaphorin 3F is a negative regulator of tumor progression and proliferation in ileal neuroendocrine tumors
Oncotarget
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
- Sample type
- HUMAN