Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035008 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA035008, RRID:AB_10604091
- Product name
- Anti-SEMA3F
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPR
EAPGAPRSPEPQDQKKPRNRRHHPPDT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Semaphorin 3F (SEMA3F) influences patient survival in esophageal adenocarcinoma
The axon guidance molecule semaphorin 3F is a negative regulator of tumor progression and proliferation in ileal neuroendocrine tumors
A Core Human Primary Tumor Angiogenesis Signature Identifies the Endothelial Orphan Receptor ELTD1 as a Key Regulator of Angiogenesis
Knipper K, Lyu S, Jung J, Alich N, Popp F, Schröder W, Fuchs H, Bruns C, Quaas A, Nienhueser H, Schmidt T
Scientific Reports 2024;14(1)
Scientific Reports 2024;14(1)
The axon guidance molecule semaphorin 3F is a negative regulator of tumor progression and proliferation in ileal neuroendocrine tumors
Bollard J, Massoma P, Vercherat C, Blanc M, Lepinasse F, Gadot N, Couderc C, Poncet G, Walter T, Joly M, Hervieu V, Scoazec J, Roche C
Oncotarget 2015;6(34):36731-36745
Oncotarget 2015;6(34):36731-36745
A Core Human Primary Tumor Angiogenesis Signature Identifies the Endothelial Orphan Receptor ELTD1 as a Key Regulator of Angiogenesis
Masiero M, Simões F, Han H, Snell C, Peterkin T, Bridges E, Mangala L, Wu S, Pradeep S, Li D, Han C, Dalton H, Lopez-Berestein G, Tuynman J, Mortensen N, Li J, Patient R, Sood A, Banham A, Harris A, Buffa F
Cancer Cell 2013;24(2):229-241
Cancer Cell 2013;24(2):229-241
No comments: Submit comment
No validations: Submit validation data