Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311282 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Torsin Family 2, Member A (TOR2A) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TOR2A antibody: synthetic peptide directed towards the N terminal of human TOR2A
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTK
PLVLS LHGWTGTGKS- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Salusin beta is a surrogate ligand of the mas-like G protein-coupled receptor MrgA1.
Wang Z, Takahashi T, Saito Y, Nagasaki H, Ly NK, Nothacker HP, Reinscheid RK, Yang J, Chang JK, Shichiri M, Civelli O
European journal of pharmacology 2006 Jun 13;539(3):145-50
European journal of pharmacology 2006 Jun 13;539(3):145-50
No comments: Submit comment
No validations: Submit validation data