H00090273-B01

CEACAM21 antibody from Abnova Corporation
FLJ13540, R29124_1

Antibody data

Product number
H00090273-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00090273-B01, RRID:AB_1573816
Product name
CEACAM21 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00090273-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CEACAM21 protein.
Antigen sequence
MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAW
LFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKG
KTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSG
DLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRV
YGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSP
PSKPAAPQSQRRAPWS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -