PAB20254

SGSM1 antibody from Abnova Corporation
KIAA1941, RUTBC2

Antibody data

Product number
PAB20254
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20254, RRID:AB_10987173
Product name
SGSM1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20254
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SGSM1.
Antigen sequence
SPDSGHPSSHNFSSGLSEHSEPSLSTEDSVLDAQR
NTPTVLRPRDGSVDDRQSSEATTSQDEAPREELAV
QDSLESDLLANESMDEFMSITGSLDMALPEKDDVV
MEGWRSSETEKHGQADSEDNLSEEPEMESLFPALA
SLAVTT
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -