HPA003986

SGSM1 antibody from Sigma-Aldrich
KIAA1941, RUTBC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003986
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003986, RRID:AB_1856513
Product name
Anti-SGSM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003986
Antibody type
Polyclonal
Antigen
Small G protein signaling modulator 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPDSGHPSSHNFSSGLSEHSEPSLSTEDSVLDAQR
NTPTVLRPRDGSVDDRQSSEATTSQDEAPREELAV
QDSLESDLLANESMDEFMSITGSLDMALPEKDDVV
MEGWRSSETEKHGQADSEDNLSEEPEMESLFPALA
SLAVTT
Storage
-20C
Provider Type Product Number
- No reagents -