HPA018033

TMEM159 antibody from Sigma-Aldrich
promethin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018033
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018033, RRID:AB_2204762
Product name
Anti-TMEM159 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018033
Antibody type
Polyclonal
Antigen
Promethin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVA
FMKSPVGQY
Storage
-20C
Provider Type Product Number
- No reagents -