HPA018033

TMEM159 antibody from Atlas Antibodies
promethin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018033
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018033, RRID:AB_1235944
Product name
Anti-TMEM159
Provider product page
Atlas Antibodies - HPA018033
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAKEEPQSISRDLQELQKKLSLLIDSFQNNSKVVA
FMKSPVGQY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -