HPA023081

KIF2B antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023081
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023081, RRID:AB_10600082
Product name
Anti-KIF2B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023081
Antibody type
Polyclonal
Antigen
kinesin family member 2B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALAPSSAIRDQRTATKWVAMIPQKNQTASGDSLDV
RVPSKPCLMKQKKSPCLWEIQKLQEQREKRRRLQQ
EIRARRALDVNTRN
Storage
-20C
Provider Type Product Number
- No reagents -