HPA024795

KIF2B antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024795
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024795, RRID:AB_10602197
Product name
Anti-KIF2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024795
Antibody type
Polyclonal
Antigen
kinesin family member 2B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPESPCLSPLKPLKPHFGDIQEGIYVAIQRSDKRI
HLAVVTEINRENYWVTVEWVEKAVKKGKKIDLETI
LLLNPALDSAEHP
Storage
-20C
Provider Type Product Number
- No reagents -