Antibody data

Product number
H00002350-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002350-M04, RRID:AB_1137219
Product name
FOLR2 monoclonal antibody (M04), clone 4B12
Provider product page
Abnova Corporation - H00002350-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FOLR2.
Antigen sequence
HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHK
DTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSP
NLGPWIQQVNQTWRKERFLDVPL
Isotype
IgG
Antibody clone number
4B12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -