HPA014788

BVES antibody from Sigma-Aldrich
HBVES, POP1, POPDC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014788
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014788, RRID:AB_1845504
Product name
Anti-BVES antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014788
Antibody type
Polyclonal
Antigen
Blood vessel epicardial substance recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIAS
SSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMK
PIEEGAEDDDDVFEPASPNTLKVHQLP
Storage
-20C
Provider Type Product Number
- No reagents -